PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10273s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 725aa    MW: 79249.5 Da    PI: 6.7128
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10273s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-193388156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          +++ +++t++q+++Le+ F+++++p++++r +L+++lgL  rq+k+WFqNrR++ k
  Bostr.10273s0021.1.p 33 KKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLK 88
                          688999**********************************************9877 PP

2START151.95.7e-482364562206
                           HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                 START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                           +a++a++el+++   +ep+W++     +++n   +  +f++s +      +++ea+r sg+v+m+++ lv  ++d   +W e ++    
  Bostr.10273s0021.1.p 236 IALTAMEELLRLLHTNEPLWTRTDgcrDILNLGSYENIFPRSSNrgknhnFRVEASRSSGIVFMNAMALVDMFMDCV-KWAELFPsiia 323
                           6899*******************99***************999999*******************************.*******9999 PP

                           EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                 START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           + +tl+vissg      gal+l + e  +lsp v+ R+f  +Ry++q ++g+w++v vS d +q+++ +    R+ ++pSg+li++++n
  Bostr.10273s0021.1.p 324 ASKTLAVISSGmggtheGALHLLYEEIEVLSPFVAtREFCELRYCQQIEQGSWIVVNVSYDLPQFVS-H---SRSYRFPSGCLIQDMPN 408
                           9*****************************************************************9.4...55556************ PP

                           CEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 160 ghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                           g skvtwveh++ +++ p h+l+r ++++g+a+ga +w+ tlqr ce+
  Bostr.10273s0021.1.p 409 GCSKVTWVEHIETEEKEPiHELYREIIHRGVAFGAERWLTTLQRMCER 456
                           **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-201491IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-221984IPR009057Homeodomain-like
PROSITE profilePS5007118.1553090IPR001356Homeobox domain
SMARTSM003891.9E-183194IPR001356Homeobox domain
CDDcd000863.19E-193391No hitNo description
PfamPF000463.1E-173388IPR001356Homeobox domain
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PROSITE profilePS5084849.597226459IPR002913START domain
SuperFamilySSF559611.89E-32227458No hitNo description
CDDcd088751.29E-102230455No hitNo description
SMARTSM002347.3E-40235456IPR002913START domain
PfamPF018527.9E-41236456IPR002913START domain
Gene3DG3DSA:3.30.530.201.5E-8283439IPR023393START-like domain
SuperFamilySSF559611.4E-20477712No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MSFVVGVGGS GSGSGGDGGG SQHHDGSETD RKKKRYHRHT AQQIQRLESS FKECPHPDEK  60
QRNQLSRELG LAPRQIKFWF QNRRTQLKAQ QERADNSALK AENDKIRCEN IAIREALKHA  120
ICPNCGGPPV SEDPYFDEQK LRIENAHLRE ELERMSTIAS KYMGRPMSQL STLHPMHISP  180
LDLSMTSLTG CGPCGHGPSL DFDLLPGSSM AVGHNNLQSQ PNLAISDMDK PLMTDIALTA  240
MEELLRLLHT NEPLWTRTDG CRDILNLGSY ENIFPRSSNR GKNHNFRVEA SRSSGIVFMN  300
AMALVDMFMD CVKWAELFPS IIAASKTLAV ISSGMGGTHE GALHLLYEEI EVLSPFVATR  360
EFCELRYCQQ IEQGSWIVVN VSYDLPQFVS HSRSYRFPSG CLIQDMPNGC SKVTWVEHIE  420
TEEKEPIHEL YREIIHRGVA FGAERWLTTL QRMCERFASL SVPASSSRDL GEVIPSPEGK  480
RSMMRLAQRM ISNYCLSVSR SNNTRSTVVS ELNEVGIRVT AHKSPEPNGT VLCAATTFWL  540
PISPQNVFNF LKDERTRPQW DVLSNGNAVQ EVAHISNGSH PGNCISVLRA SNASHSNNML  600
ILQESSTDSS GALVVYSPVD LAALNIAMGG EDPSYIPLLS SGFTISPDGN GSTSVQGGVG  660
GASTSSGRSS SSGSLITVGF QIMVSNLPSA KLNMESVETV NNLIGTTVHQ IKTALSGPTA  720
STTA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039790.0BT003979.1 Arabidopsis thaliana clone RAFL15-10-L20 (R20587) putative homeobox protein (At1g73360) mRNA, complete cds.
GenBankBT0049150.0BT004915.1 Arabidopsis thaliana clone U20587 putative homeobox protein (At1g73360) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301097.10.0hypothetical protein CARUB_v10021491mg
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLR0I7H50.0R0I7H5_9BRAS; Uncharacterized protein
STRINGAT1G73360.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11